Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Rad10p |
Rad10p is involved in:
NER in Saccharomyces cerevisiae
- recruitment of Rad1/Rad10 complex in Saccharomyces cerevisiae
- RNAP dissociates in Saccharomyces cerevisiae
- ubiquitination of Rad26 in Saccharomyces cerevisiae
- Removal of the damaged strand fragment in Saccharomyces cerevisiae
- removal of fragment of damaged strand in Saccharomyces cerevisiae
- Rad14 recruits Rad1/Rad10 complex in Saccharomyces cerevisiae
Keywords:
FUNCTION: Involved in nucleotide excision repair of DNA damaged with UV light, bulky adducts, or cross-linking agents. Along with RAD1 forms an endonuclease that specifically degrades single- stranded DNA.
SUBUNIT: Component of the nucleotide excision repair factor 1 (NEF1) complex consisting of RAD1, RAD10 and RAD14. Interacts with SAW1.
INTERACTION: P47017:LSM1; NbExp=1; IntAct=EBI-14637, EBI-174; P32266:MGM1; NbExp=1; IntAct=EBI-14637, EBI-10865; P06777:RAD1; NbExp=1; IntAct=EBI-14637, EBI-14752;
SUBCELLULAR LOCATION: Nucleus.
SIMILARITY: Belongs to the ERCC1/RAD10/SWI10 family.
| NCBI GenPept GI number(s): |
6323543 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P06838 |
P06838 |
| PFAM: | - |
P06838 (Link - using uniprot id) |
| InterPro: | - |
P06838 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MNNTDPTSFESILAGVAKLRKEKSGADTTGSQSLEIDASKLQQQEPQTSR RINSNQVINAFNQQKPEEWTDSKATDDYNRKRPFRSTRPGKTVLVNTTQK ENPLLNHLKSTNWRYVSSTGINMIYYDYLVRGRSVLFLTLTYHKLYVDYI SRRMQPLSRNENNILIFIVDDNNSEDTLNDITKLCMFNGFTLLLAFNFEQ AAKYIEYLNL |
Rad10p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Molecular cloning and characterization of the yeast RAD10 gene and expression of RAD10 protein in E. coli. | Weiss WA, Friedberg EC | EMBO J June 1, 1985 |
| Nucleotide sequence of the RAD10 gene of Saccharomyces cerevisiae. | Reynolds P, Prakash L, Dumais D, Perozzi G, Prakash S | EMBO J Dec. 16, 1985 |
| Yeast DNA repair and recombination proteins Rad1 and Rad10 constitute a single-stranded-DNA endonuclease. | Tomkinson AE, Bardwell AJ, Bardwell L, Tappe NJ, Friedberg EC | Nature April 1, 1993 |
| Nucleotide excision repair in yeast is mediated by sequential assembly of repair factors and not by a pre-assembled repairosome. | Guzder SN, Sung P, Prakash L, Prakash S | J Biol Chem April 12, 1996 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. | Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B | Nature May 1, 1997 |
| Examining protein protein interactions using endogenously tagged yeast arrays: the cross-and-capture system. | Suter B, Fetchko MJ, Imhof R, Graham CI, Stoffel-Studer I, Zbinden C, Raghavan M, Lopez L, Beneti L, Hort J, Fillingham J, Greenblatt JF, Giaever G, Nislow C, Stagljar I | Genome Res Dec. 1, 2007 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|