Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Rad1p |
Rad1p is involved in:
NER in Saccharomyces cerevisiae
- Removal of the damaged strand fragment in Saccharomyces cerevisiae
- Rad14 recruits Rad1/Rad10 complex in Saccharomyces cerevisiae
- recruitment of Rad1/Rad10 complex in Saccharomyces cerevisiae
- RNAP dissociates in Saccharomyces cerevisiae
- ubiquitination of Rad26 in Saccharomyces cerevisiae
- removal of fragment of damaged strand in Saccharomyces cerevisiae
Keywords:
FUNCTION: Involved in nucleotide excision repair of DNA damaged with UV light, bulky adducts, or cross-linking agents. Along with RAD10 forms an endonuclease that specifically degrades single- stranded DNA.
SUBUNIT: Component of the nucleotide excision repair factor 1 (NEF1) complex consisting of RAD1, RAD10 and RAD14. Interacts with SAW1.
INTERACTION: P06838:RAD10; NbExp=1; IntAct=EBI-14752, EBI-14637; P28519:RAD14; NbExp=1; IntAct=EBI-14752, EBI-14641; P39735:SAW1; NbExp=1; IntAct=EBI-14752, EBI-20627; Q12098:SLX4; NbExp=1; IntAct=EBI-14752, EBI-37788;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: Present with 1400 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the XPF family.
SIMILARITY: Contains 1 ERCC4 domain.
SEQUENCE CAUTION: Sequence=AAA34929.1; Type=Frameshift; Positions=923, 934, 948;
| NCBI GenPept GI number(s): |
6325235 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P06777 |
P06777 |
| PFAM: | - |
P06777 (Link - using uniprot id) |
| InterPro: | - |
P06777 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSQLFYQGDSDDELQEELTRQTTQASQSSKIKNEDEPDDSNHLNEVENED SKVLDDDAVLYPLIPNEPDDIETSKPNINDIRPVDIQLTLPLPFQQKVVE NSLITEDALIIMGKGLGLLDIVANLLHVLATPTSINGQLKRALVLVLNAK PIDNVRIKEALEELSWFSNTGKDDDDTAVESDDELFERPFNVVTADSLSI EKRRKLYISGGILSITSRILIVDLLSGIVHPNRVTGMLVLNADSLRHNSN ESFILEIYRSKNTWGFIKAFSEAPETFVMEFSPLRTKMKELRLKNVLLWP RFRVEVSSCLNATNKTSHNKVIEVKVSLTNSMSQIQFGLMECLKKCIAEL SRKNPELALDWWNMENVLDINFIRSIDSVMVPNWHRISYESKQLVKDIRF LRHLLKMLVTSDAVDFFGEIQLSLDANKPSVSRKYSESPWLLVDEAQLVI SYAKKRIFYKNEYTLEENPKWEQLIHILHDISHERMTNHLQGPTLVACSD NLTCLELAKVLNASNKKRGVRQVLLNKLKWYRKQREETKKLVKEVQSQDT FPENATLNVSSTFSKEQVTTKRRRTRGASQVAAVEKLRNAGTNVDMEVVF EDHKLSEEIKKGSGDDLDDGQEENAANDSKIFEIQEQENEILIDDGDAEF DNGELEYVGDLPQHITTHFNKDLWAEHCNEYEYVDRQDEILISTFKSLND NCSLQEMMPSYIIMFEPDISFIRQIEVYKAIVKDLQPKVYFMYYGESIEE QSHLTAIKREKDAFTKLIRENANLSHHFETNEDLSHYKNLAERKLKLSKL RKSNTRNAGGQQGFHNLTQDVVIVDTREFNASLPGLLYRYGIRVIPCMLT VGDYVITPDICLERKSISDLIGSLQNNRLANQCKKMLKYYAYPTLLIEFD EGQSFSLEPFSERRNYKNKDISTVHPISSKLSQDEIQLKLAKLVLRFPTL KIIWSSSPLQTVNIILELKLGREQPDPSNAVILGTNKVRSDFNSTAKGLK DGDNESKFKRLLNVPGVSKIDYFNLRKKIKSFNKLQKLSWNEINELINDE DLTDRIYYFLRTEKEEQEQESTDENLESPGKTTDDNALHDHHNDVPEAPV |
Rad1p (Saccharomyces cerevisiae) is able to recognize following damages:
Rad1p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Molecular cloning and nucleotide sequence analysis of the Saccharomyces cerevisiae RAD1 gene. | Yang E, Friedberg EC | Mol Cell Biol Oct. 1, 1984 |
| Nucleotide sequence and functional analysis of the RAD1 gene of Saccharomyces cerevisiae. | Reynolds P, Prakash L, Prakash S | Mol Cell Biol March 1, 1987 |
| Yeast DNA repair and recombination proteins Rad1 and Rad10 constitute a single-stranded-DNA endonuclease. | Tomkinson AE, Bardwell AJ, Bardwell L, Tappe NJ, Friedberg EC | Nature April 1, 1993 |
| Nucleotide excision repair in yeast is mediated by sequential assembly of repair factors and not by a pre-assembled repairosome. | Guzder SN, Sung P, Prakash L, Prakash S | J Biol Chem April 12, 1996 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. | Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. | Nature May 1, 1997 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. | Smolka MB, Albuquerque CP, Chen SH, Zhou H | Proc Natl Acad Sci U S A June 19, 2007 |
| Examining protein protein interactions using endogenously tagged yeast arrays: the cross-and-capture system. | Suter B, Fetchko MJ, Imhof R, Graham CI, Stoffel-Studer I, Zbinden C, Raghavan M, Lopez L, Beneti L, Hort J, Fillingham J, Greenblatt JF, Giaever G, Nislow C, Stagljar I | Genome Res Dec. 1, 2007 |
| Microarray-based genetic screen defines SAW1, a gene required for Rad1/Rad10-dependent processing of recombination intermediates. | Li F, Dong J, Pan X, Oum JH, Boeke JD, Lee SE | Mol Cell May 9, 2008 |
Last modification of this entry: Oct. 21, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|