|
|
Protein FULL name: DNA polymerase eta, involved in tranlesion synthesis during post-replication repair; catalyzes the synthesis of DNA opposite cyclobutane pyrimidine dimers and other lesions; mutations in human pol eta are responsible for XPV
Rad30p (Saccharomyces cerevisiae) is product of expression of
RAD30
gene.
Rad30p is involved in:
TLS in Saccharomyces cerevisiae
Keywords:
FUNCTION: DNA polymerase specifically involved in DNA repair.
Plays an important role in translesion synthesis, where the normal
high fidelity DNA polymerases cannot proceed and DNA synthesis
stalls. Plays an important role in the repair of UV-induced
pyrimidine dimers. Depending on the context, it inserts the
correct base, but causes frequent base transitions and
transversions. Efficiently incorporates nucleotides opposite to
other UV or oxidative DNA damages like O(6)-methylguanine, 7,8-
dihydro-8-oxoguanine, 2,6-diamino-4-hydroxy-5-formamidopyrimidine
of 2'-deoxyguanosine (FaPydG), or p-benzoquinone DNA adducts.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) =
diphosphate + DNA(n+1).
SUBUNIT: Interacts with POL30. This interaction is essential for
the polymerase eta function.
INTERACTION:
P06738:GPH1; NbExp=1; IntAct=EBI-36214, EBI-13389;
P48353:HLJ1; NbExp=1; IntAct=EBI-36214, EBI-8369;
P53166:MRH4; NbExp=1; IntAct=EBI-36214, EBI-23808;
P15873:POL30; NbExp=2; IntAct=EBI-36214, EBI-12993;
Q05672:RBS1; NbExp=1; IntAct=EBI-36214, EBI-36115;
P38962:TVP23; NbExp=1; IntAct=EBI-36214, EBI-22146;
SUBCELLULAR LOCATION: Nucleus.
INDUCTION: By UV radiation and heat shock. The mRNA is stabilized
during stationary phase.
MISCELLANEOUS: Present with 1860 molecules/cell in log phase SD
medium.
SIMILARITY: Belongs to the DNA polymerase type-Y family.
SIMILARITY: Contains 1 umuC domain.
Links to other databases:
Protein sequence:
MSKFTWKELIQLGSPSKAYESSLACIAHIDMNAFFAQVEQMRCGLSKEDP
VVCVQWNSIIAVSYAARKYGISRMDTIQEALKKCSNLIPIHTAVFKKGED
FWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRKALKIFKSACDLVE
RASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYD
INSHLPLIPEKIKSLKFEGDVFNPEGRDLITDWDDVILALGSQVCKGIRD
SIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDCGKF
EITSFWTLGGVLGKELIDVLDLPHENSIKHIRETWPDNAGQLKEFLDAKV
KQSDYDRSTSNIDPLKTADLAEKLFKLSRGRYGLPLSSRPVVKSMMSNKN
LRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTK
SYEVYRKSGPVAYKGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLS
MTITNFDIIDLQKTVVDMFGNQVHTFKSSAGKEDEEKTTSSKADEKTPKL
ECCKYQVTFTDQKALQEHADYHLALKLSEGLNGAEESSKNLSFGEKRLLF
SRKRPNSQHTATPQKKQVTSSKNILSFFTRKK
|
Rad30p (Saccharomyces cerevisiae) is able to recognize following damages:
Rad30p (Saccharomyces cerevisiae) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.
|
Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al.
|
Nature
May 1, 1997
|
|
The Saccharomyces cerevisiae RAD30 gene, a homologue of Escherichia coli dinB and umuC, is DNA damage inducible and functions in a novel error-free postreplication repair mechanism.
|
McDonald JP, Levine AS, Woodgate R
|
Genetics
Dec. 1, 1997
|
|
Efficient bypass of a thymine-thymine dimer by yeast DNA polymerase, Poleta.
|
Johnson RE, Prakash S, Prakash L
|
Science
Jan. 12, 1999
|
|
Requirement of DNA polymerase activity of yeast Rad30 protein for its biological function.
|
Johnson RE, Prakash S, Prakash L
|
J Biol Chem
June 4, 1999
|
|
Fidelity and processivity of Saccharomyces cerevisiae DNA polymerase eta.
|
Washington MT, Johnson RE, Prakash S, Prakash L
|
J Biol Chem
Dec. 24, 1999
|
|
Specificity of DNA lesion bypass by the yeast DNA polymerase eta.
|
Yuan F, Zhang Y, Rajpal DK, Wu X, Guo D, Wang M, Taylor JS, Wang Z
|
J Biol Chem
March 17, 2000
|
|
Accuracy of thymine-thymine dimer bypass by Saccharomyces cerevisiae DNA polymerase eta.
|
Washington MT, Johnson RE, Prakash S, Prakash L
|
Proc Natl Acad Sci U S A
March 28, 2000
|
|
The Saccharomyces cerevisiae RAD6 group is composed of an error-prone and two error-free postreplication repair pathways.
|
Xiao W, Chow BL, Broomfield S, Hanna M
|
Genetics
Aug. 1, 2000
|
|
Efficient and accurate replication in the presence of 7,8-dihydro-8-oxoguanine by DNA polymerase eta.
|
Haracska L, Yu SL, Johnson RE, Prakash L, Prakash S
|
Nat Genet
Aug. 1, 2000
|
|
Replication past O(6)-methylguanine by yeast and human DNA polymerase eta.
|
Haracska L, Prakash S, Prakash L
|
Mol Cell Biol
Nov. 1, 2000
|
|
Requirement of DNA polymerase eta for error-free bypass of UV-induced CC and TC photoproducts.
|
Yu SL, Johnson RE, Prakash S, Prakash L
|
Mol Cell Biol
Feb. 1, 2001
|
|
Mismatch extension ability of yeast and human DNA polymerase eta.
|
Washington MT, Johnson RE, Prakash S, Prakash L
|
J Biol Chem
Feb. 19, 2001
|
|
Translesion DNA synthesis by yeast DNA polymerase eta on templates containing N2-guanine adducts of 1,3-butadiene metabolites.
|
Minko IG, Washington MT, Prakash L, Prakash S, Lloyd RS
|
J Biol Chem
Feb. 26, 2001
|
|
Acidic residues critical for the activity and biological function of yeast DNA polymerase eta.
|
Kondratick CM, Washington MT, Prakash S, Prakash L
|
Mol Cell Biol
March 1, 2001
|
|
Interaction with PCNA is essential for yeast DNA polymerase eta function.
|
Haracska L, Kondratick CM, Unk I, Prakash S, Prakash L
|
Mol Cell
Aug. 1, 2001
|
|
Structure of the catalytic core of S. cerevisiae DNA polymerase eta: implications for translesion DNA synthesis.
|
Trincao J, Johnson RE, Escalante CR, Prakash S, Prakash L, Aggarwal AK
|
Mol Cell
Aug. 1, 2001
|
|
UV-induced T-->C transition at a TT photoproduct site is dependent on Saccharomyces cerevisiae polymerase eta in vivo.
|
Zhang H, Siede W
|
Nucleic Acids Res
March 1, 2002
|
|
Lesion bypass in yeast cells: Pol eta participates in a multi-DNA polymerase process.
|
Bresson A, Fuchs RP
|
EMBO J
July 15, 2002
|
|
Deoxynucleotide triphosphate binding mode conserved in Y family DNA polymerases.
|
Johnson RE, Trincao J, Aggarwal AK, Prakash S, Prakash L
|
Mol Cell Biol
April 1, 2003
|
|
Yeast DNA polymerase eta makes functional contacts with the DNA minor groove only at the incoming nucleoside triphosphate.
|
Washington MT, Wolfle WT, Spratt TE, Prakash L, Prakash S
|
Proc Natl Acad Sci U S A
April 1, 2003
|
|
Roles of Saccharomyces cerevisiae DNA polymerases Poleta and Polzeta in response to irradiation by simulated sunlight.
|
Kozmin SG, Pavlov YI, Kunkel TA, Sage E
|
Nucleic Acids Res
Aug. 1, 2003
|
|
Yeast pol eta holds a cis-syn thymine dimer loosely in the active site during elongation opposite the 3'-T of the dimer, but tightly opposite the 5'-T.
|
Sun L, Zhang K, Zhou L, Hohler P, Kool ET, Yuan F, Wang Z, Taylor JS
|
Biochemistry
Aug. 12, 2003
|
|
Mechanism of nucleotide incorporation opposite a thymine-thymine dimer by yeast DNA polymerase eta.
|
Washington MT, Prakash L, Prakash S
|
Proc Natl Acad Sci U S A
Oct. 14, 2003
|
|
Global analysis of protein expression in yeast.
|
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
|
Nature
Oct. 16, 2003
|
|
Global analysis of protein localization in budding yeast.
|
Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK
|
Nature
Oct. 16, 2003
|
|
Role of DNA polymerase eta in the bypass of abasic sites in yeast cells.
|
Zhao B, Xie Z, Shen H, Wang Z
|
Nucleic Acids Res
Jan. 1, 2004
|
|
Enzymatic switching for efficient and accurate translesion DNA replication.
|
McCulloch SD, Kokoska RJ, Chilkova O, Welch CM, Johansson E, Burgers PM, Kunkel TA
|
Nucleic Acids Res
Jan. 1, 2004
|
|
Palm mutants in DNA polymerases alpha and eta alter DNA replication fidelity and translesion activity.
|
Niimi A, Limsirichaikul S, Yoshida S, Iwai S, Masutani C, Hanaoka F, Kool ET, Nishiyama Y, Suzuki M
|
Mol Cell Biol
April 1, 2004
|
|
LC-MS/MS identification and yeast polymerase eta bypass of a novel gamma-irradiation-induced intrastrand cross-link lesion G[8-5]C.
|
Gu C, Wang Y
|
Biochemistry
June 1, 2004
|
|
Role of base stacking and sequence context in the inhibition of yeast DNA polymerase eta by pyrene nucleotide.
|
Hwang H, Taylor JS
|
Biochemistry
Nov. 23, 2004
|
|
The relative roles in vivo of Saccharomyces cerevisiae Pol eta, Pol zeta, Rev1 protein and Pol32 in the bypass and mutation induction of an abasic site, T-T (6-4) photoadduct and T-T cis-syn cyclobutane dimer.
|
Gibbs PE, McDonald J, Woodgate R, Lawrence CW
|
Genetics
Jan. 1, 2005
|
|
Evidence for Watson-Crick and not Hoogsteen or wobble base pairing in the selection of nucleotides for insertion opposite pyrimidines and a thymine dimer by yeast DNA pol eta.
|
Hwang H, Taylor JS
|
Biochemistry
March 1, 2005
|
|
Mechanism of efficient and accurate nucleotide incorporation opposite 7,8-dihydro-8-oxoguanine by Saccharomyces cerevisiae DNA polymerase eta.
|
Carlson KD, Washington MT
|
Mol Cell Biol
March 1, 2005
|
|
Transcript copy number of genes for DNA repair and translesion synthesis in yeast: contribution of transcription rate and mRNA stability to the steady-state level of each mRNA along with growth in glucose-fermentative medium.
|
Michan C, Monje-Casas F, Pueyo C
|
DNA Repair (Amst)
April 4, 2005
|
|
The p-benzoquinone DNA adducts derived from benzene are highly mutagenic.
|
Xie Z, Zhang Y, Guliaev AB, Shen H, Hang B, Singer B, Wang Z
|
DNA Repair (Amst)
Dec. 8, 2005
|
|
Base pairing and replicative processing of the formamidopyrimidine-dG DNA lesion.
|
Ober M, Muller H, Pieck C, Gierlich J, Carell T
|
J Am Chem Soc
Dec. 28, 2005
|
|
Poleta, Polzeta and Rev1 together are required for G to T transversion mutations induced by the (+)- and (-)-trans-anti-BPDE-N2-dG DNA adducts in yeast cells.
|
Zhao B, Wang J, Geacintov NE, Wang Z
|
Nucleic Acids Res
Jan. 1, 2006
|
|
The in vivo characterization of translesion synthesis across UV-induced lesions in Saccharomyces cerevisiae: insights into Pol zeta- and Pol eta-dependent frameshift mutagenesis.
|
Abdulovic AL, Jinks-Robertson S
|
Genetics
March 1, 2006
|
|
DNA synthesis past a 5-methylC-containing cis-syn-cyclobutane pyrimidine dimer by yeast pol eta is highly nonmutagenic.
|
Vu B, Cannistraro VJ, Sun L, Taylor JS
|
Biochemistry
Aug. 1, 2006
|
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|
