Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nth

Protein FULL name:

DNA glycosylase and apyrimidinic (AP) lyase (endonuclease III) [Escherichia coli str. K-12 substr. MG1655].


Nth (Escherichia coli strain K-12 substr. MG1655) is product of expression of nth gene.


Nth is involved in:

BER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Has both an apurinic and/or apyrimidinic endonuclease activity and a DNA N-glycosylase activity. Incises damaged DNA at cytosines, thymines and guanines. Acts on a damaged strand, 5' from the damaged site. Required for the repair of both oxidative DNA damage and spontaneous mutagenic lesions.

CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.

COFACTOR: Binds 1 4Fe-4S cluster. The cluster is not important for the catalytic activity, but which is probably involved in the proper positioning of the enzyme along the DNA strand.

SUBUNIT: Monomer.

INTERACTION: P0AFG8:aceE; NbExp=1; IntAct=EBI-555213, EBI-542683;

SIMILARITY: Belongs to the nth/mutY family.


NCBI GenPept GI number(s): 16129591
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0AB83 P0AB83
PFAM: - P0AB83 (Link - using uniprot id)
InterPro: - P0AB83 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MNKAKRLEILTRLRENNPHPTTELNFSSPFELLIAVLLSAQATDVSVNKA
TAKLYPVANTPAAMLELGVEGVKTYIKTIGLYNSKAENIIKTCRILLEQH
NGEVPEDRAALEALPGVGRKTANVVLNTAFGWPTIAVDTHIFRVCNRTQF
APGKNVEQVEEKLLKVVPAEFKVDCHHWLILHGRYTCIARKPRCGSCIIE
DLCEYKEKVDI

Nth (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:

Last modification of this entry: Oct. 14, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.