Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Nth |
Protein FULL name:
DNA glycosylase and apyrimidinic (AP) lyase (endonuclease III) [Escherichia coli str. K-12 substr. MG1655].
Nth (Escherichia coli strain K-12 substr. MG1655) is product of expression of nth gene.
Nth is involved in:
BER in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Has both an apurinic and/or apyrimidinic endonuclease activity and a DNA N-glycosylase activity. Incises damaged DNA at cytosines, thymines and guanines. Acts on a damaged strand, 5' from the damaged site. Required for the repair of both oxidative DNA damage and spontaneous mutagenic lesions.
CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.
COFACTOR: Binds 1 4Fe-4S cluster. The cluster is not important for the catalytic activity, but which is probably involved in the proper positioning of the enzyme along the DNA strand.
SUBUNIT: Monomer.
INTERACTION: P0AFG8:aceE; NbExp=1; IntAct=EBI-555213, EBI-542683;
SIMILARITY: Belongs to the nth/mutY family.
| NCBI GenPept GI number(s): |
16129591 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0AB83 |
P0AB83 |
| PFAM: | - |
P0AB83 (Link - using uniprot id) |
| InterPro: | - |
P0AB83 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MNKAKRLEILTRLRENNPHPTTELNFSSPFELLIAVLLSAQATDVSVNKA TAKLYPVANTPAAMLELGVEGVKTYIKTIGLYNSKAENIIKTCRILLEQH NGEVPEDRAALEALPGVGRKTANVVLNTAFGWPTIAVDTHIFRVCNRTQF APGKNVEQVEEKLLKVVPAEFKVDCHHWLILHGRYTCIARKPRCGSCIIE DLCEYKEKVDI |
Nth (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
Last modification of this entry: Oct. 14, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|