Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Mag1p

Protein FULL name:

3-methyl-adenine DNA glycosylase involved in protecting DNA against alkylating agents; initiates base excision repair by removing damaged bases to create abasic sites that are subsequently repaired


Protein SHORT name:

MMS5


Mag1p (Saccharomyces cerevisiae) is product of expression of MAG1 gene.


Mag1p is involved in:

BER in Saccharomyces cerevisiae

Keywords:



FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine or 7-methyladenine from the damaged DNA polymer formed by alkylation lesions.

CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3- methyladenine, 3-methylguanine, 7-methylguanine and 7- methyladenine.

INTERACTION: P04817:CAN1; NbExp=1; IntAct=EBI-10381, EBI-3993;

SUBCELLULAR LOCATION: Nucleus.

INDUCTION: By DNA damage.

SIMILARITY: Belongs to the alkylbase DNA glycosidase alkA family.


NCBI GenPept GI number(s): 6320990
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P22134 P22134
PFAM: - P22134 (Link - using uniprot id)
InterPro: - P22134 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MKLKREYDELIKADAVKEIAKELGSRPLEVALPEKYIARHEEKFNMACEH
ILEKDPSLFPILKNNEFTLYLKETQVPNTLEDYFIRLASTILSQQISGQA
AESIKARVVSLYGGAFPDYKILFEDFKDPAKCAEIAKCGLSKRKMIYLES
LAVYFTEKYKDIEKLFGQKDNDEEVIESLVTNVKGIGPWSAKMFLISGLK
RMDVFAPEDLGIARGFSKYLSDKPELEKELMRERKVVKKSKIKHKKYNWK
IYDDDIMEKCSETFSPYRSVFMFILWRLASTNTDAMMKAEENFVKS

Mag1p (Saccharomyces cerevisiae) is able to recognize following damages:
References:

Title Authors Journal
Cloning and expression in Escherichia coli of a gene for an alkylbase DNA glycosylase from Saccharomyces cerevisiae; a homologue to the bacterial alkA gene. Berdal KG, Bjoras M, Bjelland S, Seeberg E EMBO J Dec. 1, 1990
Saccharomyces cerevisiae 3-methyladenine DNA glycosylase has homology to the AlkA glycosylase of E. coli and is induced in response to DNA alkylation damage. Chen J, Derfler B, Samson L EMBO J Dec. 1, 1990
Purification and properties of the alkylation repair DNA glycosylase encoded the MAG gene from Saccharomyces cerevisiae. Bjoras M, Klungland A, Johansen RF, Seeberg E Biochemistry April 11, 1995
The nucleotide sequence of Saccharomyces cerevisiae chromosome V. Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al. Nature May 1, 1997
Yeast mitochondrial dehydrogenases are associated in a supramolecular complex. Grandier-Vazeille X, Bathany K, Chaignepain S, Camougrand N, Manon S, Schmitter JM Biochemistry Aug. 21, 2001
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res April 1, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.