Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Tag

Protein FULL name:

3-methyl-adenine DNA glycosylase I, constitutive [Escherichia coli str. K-12 substr. MG1655].


Tag (Escherichia coli strain K-12 substr. MG1655) is product of expression of tag gene.


Tag is involved in:

BER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine from the damaged DNA polymer formed by alkylation lesions.

CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3- methyladenine.

ENZYME REGULATION: Activity is controlled by product inhibition.

INTERACTION: P0AFG8:aceE; NbExp=1; IntAct=EBI-558722, EBI-542683;


NCBI GenPept GI number(s): 16131420
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P05100 P05100
PFAM: - P05100 (Link - using uniprot id)
InterPro: - P05100 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVL
KKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNAR
AYLQMEQNGEPFVDFVWSFVNHQPQVTQATTLSEIPTSTSASDALSKALK
KRGFKFVGTTICYSFMQACGLVNDHVVGCCCYPGNKP

Tag (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:

Title Authors Journal
Nucleotide sequence of the tag gene from Escherichia coli. Steinum AL, Seeberg E Nucleic Acids Res May 12, 1986
Purification and structure of 3-methyladenine-DNA glycosylase I of Escherichia coli. Sakumi K, Nakabeppu Y, Yamamoto Y, Kawabata S, Iwanaga S, Sekiguchi M J Biol Chem Nov. 25, 1986
Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes. Sofia HJ, Burland V, Daniels DL, Plunkett G 3rd, Blattner FR Nucleic Acids Res July 11, 1994
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
3-Methyladenine DNA glycosylase I is an unexpected helix-hairpin-helix superfamily member. Drohat AC, Kwon K, Krosky DJ, Stivers JT Nat Struct Biol Sept. 1, 2002
A novel zinc snap motif conveys structural stability to 3-methyladenine DNA glycosylase I. Kwon K, Cao C, Stivers JT J Biol Chem May 23, 2003
Solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine DNA glycosylase I. Cao C, Kwon K, Jiang YL, Drohat AC, Stivers JT J Biol Chem Nov. 28, 2003
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.