Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Tag |
Protein FULL name:
3-methyl-adenine DNA glycosylase I, constitutive [Escherichia coli str. K-12 substr. MG1655].
Tag (Escherichia coli strain K-12 substr. MG1655) is product of expression of tag gene.
Tag is involved in:
BER in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine from the damaged DNA polymer formed by alkylation lesions.
CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3- methyladenine.
ENZYME REGULATION: Activity is controlled by product inhibition.
INTERACTION: P0AFG8:aceE; NbExp=1; IntAct=EBI-558722, EBI-542683;
| NCBI GenPept GI number(s): |
16131420 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P05100 |
P05100 |
| PFAM: | - |
P05100 (Link - using uniprot id) |
| InterPro: | - |
P05100 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVL KKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNAR AYLQMEQNGEPFVDFVWSFVNHQPQVTQATTLSEIPTSTSASDALSKALK KRGFKFVGTTICYSFMQACGLVNDHVVGCCCYPGNKP |
Tag (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Nucleotide sequence of the tag gene from Escherichia coli. | Steinum AL, Seeberg E | Nucleic Acids Res May 12, 1986 |
| Purification and structure of 3-methyladenine-DNA glycosylase I of Escherichia coli. | Sakumi K, Nakabeppu Y, Yamamoto Y, Kawabata S, Iwanaga S, Sekiguchi M | J Biol Chem Nov. 25, 1986 |
| Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes. | Sofia HJ, Burland V, Daniels DL, Plunkett G 3rd, Blattner FR | Nucleic Acids Res July 11, 1994 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| 3-Methyladenine DNA glycosylase I is an unexpected helix-hairpin-helix superfamily member. | Drohat AC, Kwon K, Krosky DJ, Stivers JT | Nat Struct Biol Sept. 1, 2002 |
| A novel zinc snap motif conveys structural stability to 3-methyladenine DNA glycosylase I. | Kwon K, Cao C, Stivers JT | J Biol Chem May 23, 2003 |
| Solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine DNA glycosylase I. | Cao C, Kwon K, Jiang YL, Drohat AC, Stivers JT | J Biol Chem Nov. 28, 2003 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|