Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
AlkA |
Protein FULL name:
DNA-3-methyladenine glycosylase 2, DNA-3-methyladenine glycosylase II, 3-methyladenine-DNA glycosylase II, inducible, DNA-3-methyladenine glycosidase II.,
Protein SHORT name:
TAG II
AlkA (Escherichia coli strain K-12 substr. MG1655) is product of expression of alkA gene.
AlkA is involved in:
BER in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, 3-methylguanine, 7-methylguanine, O2- methylthymine, and O2-methylcytosine from the damaged DNA polymer formed by alkylation lesions.
CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3- methyladenine, 3-methylguanine, 7-methylguanine and 7- methyladenine.
SUBUNIT: Monomer.
INTERACTION: P06959:aceF; NbExp=1; IntAct=EBI-544077, EBI-542707;
INDUCTION: When E.coli cells are exposed to doses of DNA alkylating agent. It is not inhibited by reaction products.
SIMILARITY: Belongs to the alkylbase DNA glycosidase alkA family.
| NCBI GenPept GI number(s): |
112786 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P04395 |
P04395 |
| PFAM: |
PF06029 PF00730 |
PF06029 PF00730 |
| InterPro: |
IPR010316 IPR000035 IPR011257 IPR003265 IPR012294 |
IPR010316 IPR000035 IPR011257 IPR003265 IPR012294 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTA IPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGA ARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFP EYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPG DVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTP AQIRRYAERWKPWRSYALLHIWYTEGWQPDEA |
AlkA (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
AlkA (Escherichia coli strain K-12 substr. MG1655) belongs to following protein families:
References:
| Title | Authors | Journal |
| Structure and expression of the alkA gene of Escherichia coli involved in adaptive response to alkylating agents. | Nakabeppu Y, Miyata T, Kondo H, Iwanaga S, Sekiguchi M | J Biol Chem Nov. 25, 1984 |
| Cloning and characterization of the alkA gene of Escherichia coli that encodes 3-methyladenine DNA glycosylase II. | Nakabeppu Y, Kondo H, Sekiguchi M | J Biol Chem Nov. 25, 1984 |
| Regulatory mechanisms for induction of synthesis of repair enzymes in response to alkylating agents: ada protein acts as a transcriptional regulator. | Nakabeppu Y, Sekiguchi M | Proc Natl Acad Sci U S A Sept. 1, 1986 |
| Three-dimensional structure of a DNA repair enzyme, 3-methyladenine DNA glycosylase II, from Escherichia coli. | Yamagata Y, Kato M, Odawara K, Tokuno Y, Nakashima Y, Matsushima N, Yasumura K, Tomita K, Ihara K, Fujii Y, Nakabeppu Y, Sekiguchi M, Fujii S | Cell July 26, 1996 |
| Structural basis for the excision repair of alkylation-damaged DNA. | Labahn J, Scharer OD, Long A, Ezaz-Nikpay K, Verdine GL, Ellenberger TE | Cell July 26, 1996 |
| A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. | Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. | DNA Res Dec. 31, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 22, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|