Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

AlkA

Protein FULL name:

DNA-3-methyladenine glycosylase 2, DNA-3-methyladenine glycosylase II, 3-methyladenine-DNA glycosylase II, inducible, DNA-3-methyladenine glycosidase II.,


Protein SHORT name:

TAG II


AlkA (Escherichia coli strain K-12 substr. MG1655) is product of expression of alkA gene.


AlkA is involved in:

BER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, 3-methylguanine, 7-methylguanine, O2- methylthymine, and O2-methylcytosine from the damaged DNA polymer formed by alkylation lesions.

CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3- methyladenine, 3-methylguanine, 7-methylguanine and 7- methyladenine.

SUBUNIT: Monomer.

INTERACTION: P06959:aceF; NbExp=1; IntAct=EBI-544077, EBI-542707;

INDUCTION: When E.coli cells are exposed to doses of DNA alkylating agent. It is not inhibited by reaction products.

SIMILARITY: Belongs to the alkylbase DNA glycosidase alkA family.


NCBI GenPept GI number(s): 112786
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P04395 P04395
PFAM: PF06029
PF00730
PF06029
PF00730
InterPro: IPR010316
IPR000035
IPR011257
IPR003265
IPR012294
IPR010316
IPR000035
IPR011257
IPR003265
IPR012294
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTA
IPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGA
ARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFP
EYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPG
DVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTP
AQIRRYAERWKPWRSYALLHIWYTEGWQPDEA

AlkA (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
AlkA (Escherichia coli strain K-12 substr. MG1655) belongs to following protein families:
References:

Title Authors Journal
Structure and expression of the alkA gene of Escherichia coli involved in adaptive response to alkylating agents. Nakabeppu Y, Miyata T, Kondo H, Iwanaga S, Sekiguchi M J Biol Chem Nov. 25, 1984
Cloning and characterization of the alkA gene of Escherichia coli that encodes 3-methyladenine DNA glycosylase II. Nakabeppu Y, Kondo H, Sekiguchi M J Biol Chem Nov. 25, 1984
Regulatory mechanisms for induction of synthesis of repair enzymes in response to alkylating agents: ada protein acts as a transcriptional regulator. Nakabeppu Y, Sekiguchi M Proc Natl Acad Sci U S A Sept. 1, 1986
Three-dimensional structure of a DNA repair enzyme, 3-methyladenine DNA glycosylase II, from Escherichia coli. Yamagata Y, Kato M, Odawara K, Tokuno Y, Nakashima Y, Matsushima N, Yasumura K, Tomita K, Ihara K, Fujii Y, Nakabeppu Y, Sekiguchi M, Fujii S Cell July 26, 1996
Structural basis for the excision repair of alkylation-damaged DNA. Labahn J, Scharer OD, Long A, Ezaz-Nikpay K, Verdine GL, Ellenberger TE Cell July 26, 1996
A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. DNA Res Dec. 31, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 22, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.