|
|
Protein FULL name: DNA-3-methyladenine glycosylase (3-methyladenine DNA glycosidase) (ADPG) (3-alkyladenine DNA glycosylase) (N-methylpurine-DNA glycosylase).
MPG (Homo sapiens) is product of expression of
MPG
gene.
MPG is involved in:
BER in Homo sapiens
Keywords:
FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to
excise 3-methyladenine, and 7-methylguanine from the damaged DNA
polymer formed by alkylation lesions.
CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3-
methyladenine, 3-methylguanine, 7-methylguanine and 7-
methyladenine.
SUBUNIT: Binds MBD1.
INTERACTION:
Self; NbExp=1; IntAct=EBI-1043398, EBI-1043398;
P23142:FBLN1; NbExp=1; IntAct=EBI-1043398, EBI-726652;
P21266:GSTM3; NbExp=1; IntAct=EBI-1043398, EBI-350350;
Q96AG4:LRRC59; NbExp=1; IntAct=EBI-1043398, EBI-358888;
P04156:PRNP; NbExp=2; IntAct=EBI-1043398, EBI-977302;
P43487:RANBP1; NbExp=1; IntAct=EBI-1043398, EBI-1032909;
SUBCELLULAR LOCATION: Nucleus (Potential).
SIMILARITY: Belongs to the DNA glycosylase MPG family.
WEB RESOURCE: Name=NIEHS-SNPs;
[LINK]
Links to other databases:
| Database
|
ID
|
Link
|
|
Uniprot
|
P29372
|
P29372
|
|
PFAM:
|
PF02245
|
PF02245
|
|
InterPro:
|
IPR003180
|
IPR003180
|
|
CATH:
|
None
|
|
|
SCOP:
|
None
|
|
|
PDB:
|
-
|
-
|
Protein sequence:
MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSD
AAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPAVPLAR
AFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMF
MKPGTLYVYIIYGMYFCMNISSQGDGACVLLRALEPLEGLETMRHVRSTL
RKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLE
PSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
|
MPG (Homo sapiens) is able to recognize following damages:
MPG (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Human cDNA expressing a functional DNA glycosylase excising 3-methyladenine and 7-methylguanine.
|
O'Connor TR, Laval J
|
Biochem Biophys Res Commun
May 15, 1991
|
|
Cloning and expression in Escherichia coli of a human cDNA encoding the DNA repair protein N-methylpurine-DNA glycosylase.
|
Chakravarti D, Ibeanu GC, Tano K, Mitra S
|
J Biol Chem
Aug. 25, 1991
|
|
Cloning and characterization of a 3-methyladenine DNA glycosylase cDNA from human cells whose gene maps to chromosome 16.
|
Samson L, Derfler B, Boosalis M, Call K
|
Proc Natl Acad Sci U S A
Oct. 15, 1991
|
|
Homology of a 130-kb region enclosing the alpha-globin gene cluster, the alpha-locus controlling region, and two non-globin genes in human and mouse.
|
Kielman MF, Smits R, Devi TS, Fodde R, Bernini LF
|
Mamm Genome
Jan. 1, 1993
|
|
Structure of the human 3-methyladenine DNA glycosylase gene and localization close to the 16p telomere.
|
Vickers MA, Vyas P, Harris PC, Simmons DL, Higgs DR
|
Proc Natl Acad Sci U S A
April 15, 1993
|
|
Crystal structure of a human alkylbase-DNA repair enzyme complexed to DNA: mechanisms for nucleotide flipping and base excision.
|
Lau AY, Scharer OD, Samson L, Verdine GL, Ellenberger T
|
Cell
Oct. 16, 1998
|
|
Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
|
Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR
|
Hum Mol Genet
Jan. 15, 2001
|
|
Methylated DNA-binding domain 1 and methylpurine-DNA glycosylase link transcriptional repression and DNA repair in chromatin.
|
Watanabe S, Ichimura T, Fujita N, Tsuruzoe S, Ohki I, Shirakawa M, Kawasuji M, Nakao M
|
Proc Natl Acad Sci U S A
Oct. 28, 2003
|
|
Large-scale characterization of HeLa cell nuclear phosphoproteins.
|
Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 17, 2004
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
The sequence and analysis of duplication-rich human chromosome 16.
|
Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA
|
Nature
Dec. 23, 2004
|
|
A quantitative atlas of mitotic phosphorylation.
|
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 5, 2008
|
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|