|
|
Protein FULL name: Uracil-DNA glycosylase,
Protein SHORT name: UDG.
UNG (Homo sapiens) is product of expression of
UNG
gene.
Human diseases related to this protein:
UNG is involved in:
BER in Homo sapiens
Keywords:
FUNCTION: Excises uracil residues from the DNA which can arise as
a result of misincorporation of dUMP residues by DNA polymerase or
due to deamination of cytosine.
CATALYTIC ACTIVITY: Hydrolyzes single-stranded DNA or mismatched
double-stranded DNA and polynucleotides, releasing free uracil.
SUBUNIT: Monomer. Interacts with HIV-1 Vpr.
INTERACTION:
P14739:UGI (xeno); NbExp=1; IntAct=EBI-1025947, EBI-1025973;
SUBCELLULAR LOCATION: Isoform 1: Mitochondrion.
SUBCELLULAR LOCATION: Isoform 2: Nucleus.
TISSUE SPECIFICITY: Isoform 1 is widely expressed with the highest
expression in skeletal muscle, heart and testicles. Isoform 2 has
the highest expression levels in tissues containing proliferating
cells.
PTM: Isoform 1 is processed by cleavage of a transit peptide.
DISEASE: Defects in UNG are a cause of immunodeficiency with
hyper-IgM type 5 syndrome (HIGM5) [MIM:608106]. Hyper-IgM syndrome
is a condition characterized by normal or increased serum IgM
concentrations associated with low or absent serum IgG, IgA, and
IgE concentrations. HIGM5 is associated with profound impairment
in immunoglobulin (Ig) class-switch recombination (CSR) at a DNA
precleavage step.
SIMILARITY: Belongs to the uracil-DNA glycosylase family.
WEB RESOURCE: Name=GeneReviews;
[LINK]
WEB RESOURCE: Name=NIEHS-SNPs;
[LINK]
WEB RESOURCE: Name=UNGbase; Note=UNG mutation db;
[LINK]
Links to other databases:
Protein sequence:
MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKK
APAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKK
HLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVI
LGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGD
LSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLV
FLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELL
QKSGKKPIDWKEL
|
UNG (Homo sapiens) is able to recognize following damages:
UNG (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Molecular cloning of human uracil-DNA glycosylase, a highly conserved DNA repair enzyme.
|
Olsen LC, Aasland R, Wittwer CU, Krokan HE, Helland DE
|
EMBO J
Oct. 1, 1989
|
|
Nuclear and mitochondrial forms of human uracil-DNA glycosylase are encoded by the same gene.
|
Slupphaug G, Markussen FH, Olsen LC, Aasland R, Aarsaether N, Bakke O, Krokan HE, Helland DE
|
Nucleic Acids Res
June 11, 1993
|
|
Structure of the gene for human uracil-DNA glycosylase and analysis of the promoter function.
|
Haug T, Skorpen F, Lund H, Krokan HE
|
FEBS Lett
Oct. 17, 1994
|
|
Crystal structure and mutational analysis of human uracil-DNA glycosylase: structural basis for specificity and catalysis.
|
Mol CD, Arvai AS, Slupphaug G, Kavli B, Alseth I, Krokan HE, Tainer JA
|
Cell
March 24, 1995
|
|
Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA.
|
Mol CD, Arvai AS, Sanderson RJ, Slupphaug G, Kavli B, Krokan HE, Mosbaugh DW, Tainer JA
|
Cell
Sept. 8, 1995
|
|
Human immunodeficiency virus type 1 Vpr protein binds to the uracil DNA glycosylase DNA repair enzyme.
|
Bouhamdan M, Benichou S, Rey F, Navarro JM, Agostini I, Spire B, Camonis J, Slupphaug G, Vigne R, Benarous R, Sire J
|
J Virol
Jan. 1, 1996
|
|
Excision of cytosine and thymine from DNA by mutants of human uracil-DNA glycosylase.
|
Kavli B, Slupphaug G, Mol CD, Arvai AS, Peterson SB, Tainer JA, Krokan HE
|
EMBO J
July 1, 1996
|
|
A nucleotide-flipping mechanism from the structure of human uracil-DNA glycosylase bound to DNA.
|
Slupphaug G, Mol CD, Kavli B, Arvai AS, Krokan HE, Tainer JA
|
Nature
Nov. 7, 1996
|
|
Nuclear and mitochondrial uracil-DNA glycosylases are generated by alternative splicing and transcription from different positions in the UNG gene.
|
Nilsen H, Otterlei M, Haug T, Solum K, Nagelhus TA, Skorpen F, Krokan HE
|
Nucleic Acids Res
Jan. 15, 1997
|
|
Base excision repair initiation revealed by crystal structures and binding kinetics of human uracil-DNA glycosylase with DNA.
|
Parikh SS, Mol CD, Slupphaug G, Bharati S, Krokan HE, Tainer JA
|
EMBO J
Sept. 1, 1998
|
|
Nuclear and mitochondrial splice forms of human uracil-DNA glycosylase contain a complex nuclear localisation signal and a strong classical mitochondrial localisation signal, respectively.
|
Otterlei M, Haug T, Nagelhus TA, Slupphaug G, Lindmo T, Krokan HE
|
Nucleic Acids Res
Oct. 15, 1998
|
|
Human uracil-DNA glycosylase deficiency associated with profoundly impaired immunoglobulin class-switch recombination.
|
Imai K, Slupphaug G, Lee WI, Revy P, Nonoyama S, Catalan N, Yel L, Forveille M, Kavli B, Krokan HE, Ochs HD, Fischer A, Durandy A
|
Nat Immunol
Oct. 1, 2003
|
|
Complete sequencing and characterization of 21,243 full-length human cDNAs.
|
Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S
|
Nat Genet
Feb. 1, 2004
|
|
Large-scale characterization of HeLa cell nuclear phosphoproteins.
|
Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 17, 2004
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
B cells from hyper-IgM patients carrying UNG mutations lack ability to remove uracil from ssDNA and have elevated genomic uracil.
|
Kavli B, Andersen S, Otterlei M, Liabakk NB, Imai K, Fischer A, Durandy A, Krokan HE, Slupphaug G
|
J Exp Med
June 20, 2005
|
|
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
|
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
|
Cell
Nov. 3, 2006
|
|
Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.
|
Molina H, Horn DM, Tang N, Mathivanan S, Pandey A
|
Proc Natl Acad Sci U S A
Jan. 13, 2007
|
|
Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
|
Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd
|
J Proteome Res
March 1, 2008
|
|
A quantitative atlas of mitotic phosphorylation.
|
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 5, 2008
|
|
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
|
Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK
|
Sci Signal
Jan. 1, 2009
|
|
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
|
Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S
|
Anal Chem
June 1, 2009
|
|
Lysine acetylation targets protein complexes and co-regulates major cellular functions.
|
Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M
|
Science
Aug. 14, 2009
|
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|