Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
APEX1 |
Protein FULL name:
DNA-(apurinic or apyrimidinic site) lyase, Apurinic-apyrimidinic endonuclease 1, APEX nuclease, Protein REF-1.,
Protein SHORT name:
AP endonuclease 1 APEN
APEX1 (Homo sapiens) is product of expression of APEX1 gene.
APEX1 is involved in:
BER in Homo sapiens
Keywords:
FUNCTION: Repairs oxidative DNA damages in vitro. May have a role in protection against cell lethality and suppression of mutations. Removes the blocking groups from the 3'-termini of the DNA strand breaks generated by ionizing radiations and bleomycin.
CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.
SUBUNIT: Monomer. Component of the SET complex, which also contains SET, ANP32A, HMGB2 and NME1.
SUBCELLULAR LOCATION: Nucleus.
SIMILARITY: Belongs to the DNA repair enzymes AP/exoA family.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
113984 18375501 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | P27695 |
P27695 |
| PFAM: |
PF03372 |
PF03372 |
| InterPro: |
IPR000097 IPR020847 IPR020848 IPR005135 IPR004808 |
IPR000097 IPR020847 IPR020848 IPR005135 IPR004808 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPD QKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCS ENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEE HDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLA SRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLA DSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI RSKALGSDHCPITLYLAL |
APEX1 (Homo sapiens) is able to recognize following damages:
APEX1 (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| Isolation of cDNA clones encoding a human apurinic/apyrimidinic endonuclease that corrects DNA repair and mutagenesis defects in E. coli xth (exonuclease III) mutants. | Robson CN, Hickson ID | Nucleic Acids Res Oct. 25, 1991 |
| Cloning and expression of APE, the cDNA encoding the major human apurinic endonuclease: definition of a family of DNA repair enzymes. | Demple B, Herman T, Chen DS | Proc Natl Acad Sci U S A Dec. 15, 1991 |
| Nucleotide sequence of a cDNA for an apurinic/apyrimidinic endonuclease from HeLa cells. | Cheng XB, Bunville J, Patterson TA | Nucleic Acids Res Feb. 25, 1992 |
| cDNA cloning, sequencing, expression and possible domain structure of human APEX nuclease homologous to Escherichia coli exonuclease III. | Seki S, Hatsushika M, Watanabe S, Akiyama K, Nagao K, Tsutsui K | Biochim Biophys Acta July 15, 1992 |
| The human gene for apurinic/apyrimidinic endonuclease (HAP1): sequence and localization to chromosome 14 band q12. | Zhao B, Grandy DK, Hagerup JM, Magenis RE, Smith L, Chauhan BC, Henner WD | Nucleic Acids Res Aug. 11, 1992 |
| Redox activation of Fos-Jun DNA binding activity is mediated by a DNA repair enzyme. | Xanthoudakis S, Miao G, Wang F, Pan YC, Curran T | EMBO J Sept. 1, 1992 |
| Structure of the human DNA repair gene HAP1 and its localisation to chromosome 14q 11.2-12. | Robson CN, Hochhauser D, Craig R, Rack K, Buckle VJ, Hickson ID | Nucleic Acids Res Sept. 11, 1992 |
| Human apurinic endonuclease gene (APE): structure and genomic mapping (chromosome 14q11.2-12). | Harrison L, Ascione G, Menninger JC, Ward DC, Demple B | Hum Mol Genet Dec. 1, 1992 |
| Structure, promoter analysis and chromosomal assignment of the human APEX gene. | Akiyama K, Seki S, Oshida T, Yoshida MC | Biochim Biophys Acta Sept. 13, 1994 |
| Asparagine 212 is essential for abasic site recognition by the human DNA repair endonuclease HAP1. | Rothwell DG, Hickson ID | Nucleic Acids Res Nov. 1, 1996 |
| Large-scale concatenation cDNA sequencing. | Yu W, Andersson B, Worley KC, Muzny DM, Ding Y, Liu W, Ricafrente JY, Wentland MA, Lennon G, Gibbs RA | Genome Res April 1, 1997 |
| The crystal structure of the human DNA repair endonuclease HAP1 suggests the recognition of extra-helical deoxyribose at DNA abasic sites. | Gorman MA, Morera S, Rothwell DG, de La Fortelle E, Mol CD, Tainer JA, Hickson ID, Freemont PS | EMBO J Nov. 3, 1997 |
| DNA-bound structures and mutants reveal abasic DNA binding by APE1 and DNA repair coordination [corrected] | Mol CD, Izumi T, Mitra S, Tainer JA | Nature Feb. 27, 2000 |
| Two divalent metal ions in the active site of a new crystal form of human apurinic/apyrimidinic endonuclease, Ape1: implications for the catalytic mechanism. | Beernink PT, Segelke BW, Hadi MZ, Erzberger JP, Wilson DM 3rd, Rupp B | J Mol Biol April 6, 2001 |
| Cleaving the oxidative repair protein Ape1 enhances cell death mediated by granzyme A. | Fan Z, Beresford PJ, Zhang D, Xu Z, Novina CD, Yoshida A, Pommier Y, Lieberman J | Nat Immunol Jan. 1, 2003 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. | Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ | Nat Biotechnol Feb. 1, 2005 |
| Lysine acetylation targets protein complexes and co-regulates major cellular functions. | Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M | Science Aug. 14, 2009 |
Last modification of this entry: Oct. 16, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|